Exendin-4

Exendin-4 구조식 이미지
카스 번호:
141758-74-9
상품명:
Exendin-4
동의어(영문):
HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2;H-HIS-GLY-GLU-GLY-THR-PHE-THR-SER-ASP-LEU-SER-LYS-GLN-MET-GLU-GLU-GLU-ALA-VAL-ARG-LEU-PHE-ILE-GLU-TRP-LEU-LYS-ASN-GLY-GLY-PRO-SER-SER-GLY-ALA-PRO-PRO-PRO-SER-NH2;XENDIN-4;EXENDIN-4;Exendin-4 >=97%;Exendin-4 Exenatide;Exenatide (2.73 mg);Exenatide free base;Exendin-4 USP/EP/BP;Exenatide (Exendin-4)
CBNumber:
CB7738335
분자식:
C184H282N50O60S
포뮬러 무게:
4186.57188
MOL 파일:
141758-74-9.mol
MSDS 파일:
SDS

Exendin-4 속성

RTECS 번호
VT9545000
저장 조건
−20°C
용해도
≥145 mg/mL in DMSO; insoluble in EtOH; ≥52 mg/mL in H2O with gentle warming
물리적 상태
흰색 내지 회백색 고체.
색상
White to off-white
수용성
Soluble in water (1 mg/ml)
InChIKey
HTQBXNHDCUEHJF-AAPNSGCPNA-N
안전
  • 위험 및 안전 성명
  • 위험 및 사전주의 사항 (GHS)
WGK 독일 3
HS 번호 2933290000
유해 물질 데이터 141758-74-9(Hazardous Substances Data)
그림문자(GHS): GHS hazard pictograms
신호 어: Warning
유해·위험 문구:
암호 유해·위험 문구 위험 등급 범주 신호 어 그림 문자 P- 코드
H351 암을 일으킬 것으로 의심됨 (노출되어도 암을 일으키지 않는다는 결정적인 증거가 있는 노출경로가 있다면 노출경로 기재) 발암성 물질 구분 2 경고 P201, P202, P281, P308+P313, P405,P501
H361 태아 또는 생식능력에 손상을 일으킬 것으로 의심됨 생식독성 물질 구분 2 경고 P201, P202, P281, P308+P313, P405,P501
예방조치문구:
P201 사용 전 취급 설명서를 확보하시오.
P202 모든 안전 조치 문구를 읽고 이해하기 전에는 취급하지 마시오.
P281 요구되는 개인 보호구를 착용하시오
P308+P313 노출 또는 접촉이 우려되면 의학적인 조치· 조언를 구하시오.
P405 밀봉하여 저장하시오.
P501 ...에 내용물 / 용기를 폐기 하시오.

Exendin-4 C화학적 특성, 용도, 생산

개요

Exenatide is the first drug in a new class of anti-diabetics known as the incretin mimetics, and it is indicated as adjunctive therapy to improve glycemic control in patients with type 2 diabetes who are taking metformin, a sulfonylurea, or both, but have not achieved adequate glycemic control. Exenatide is a functional analog of the human incretin Glucagon-Like Peptide-1 (GLP-1). GLP-1 is naturally released from cells in the GI tract in response to food intake and acts on its receptor on b-cells to potentiate glucose-stimulated insulin secretion. Exenatide is a long-acting agonist at the GLP-1 receptor. It is a synthetic version of a 39-amino acid peptide found in the salivary secretions of the Gila monster lizard.also moderates peak serum glucagon levels during hyperglycemic periods following meals, but does not interfere with glucagon release in response to hypoglycemia. The dosing regimen for exenatide is 5 or 10 mg twice daily, administered as a subcutaneous injection within an hour before morning and evening meals. Following subcutaneous administration, peak plasma concentrations of exenatide are reached in 2.1 h, and the plasma pharmacokinetic profile is dose proportional. The most common adverse events reported with exenatide include nausea, vomiting, diarrhea, feeling jittery, dizziness, headache, and dyspepsia.

개요

Exendin-4 is a 39 amino acid polypeptide and incretin mimetic involved in the glucose-dependent enhancement of insulin secretion. It was first isolated from Gila monster saliva. It also promotes the reduction of hyperglycemia, glucose-dependent suppression of inappropriately high glucagon secretion, slowing of gastric emptying, and reduction of food intake, often with body weight reduction or blunting of weight gain. The synthetic form, Exenatide, is a glucagon-like peptide-1 (GLP-1) agonist approved for the treatment of diabetes mellitus type II, has a long half-life.

용도

Exendin-4 has been used as incretin mimetics for the treatment in HepG2 cells to exclude the influence of auxiliary material. It has also been used as an r (GLP-1R) agonist to exclude interference from auxiliary material.

정의

ChEBI: A bioactive polypeptide of 39 amino acid residues isolated from the saliva of the Gila monster (Heloderma suspectum). High-affinity glucagon-like peptide 1 (GLP-1) receptor agonist (Kd = 136 pM); potently indu es cAMP formation without stimulating amylase release in pancreatic acini; potentiates glucose-induced insulin secretion in isolated rat islets; protects against glutamate-induced neurotoxicity. A synthetic version is called exenatide.

일반 설명

Exendin-4 is an incretin mimetic peptide, which is composed of 39 amino acids. It is an analog of glucagon-like peptide 1 (GLP-1), and an insulinotropic agent, with a long half-life. Exendin-4 was historically isolated from the venom of Gila monster lizard called Heloderma suspectum.

Exendin-4 준비 용품 및 원자재

원자재

준비 용품


Exendin-4 공급 업체

글로벌( 265)공급 업체
공급자 전화 이메일 국가 제품 수 이점
BOC Sciences
16314854226; +16314854226
inquiry@bocsci.com United States 19743 58
GIHI CHEMICALS CO.,LIMITED
+8618058761490
info@gihichemicals.com China 49999 58
Henan Bao Enluo International TradeCo.,LTD
+86-17331933971 +86-17331933971
deasea125996@gmail.com China 2503 58
Zibo Hangyu Biotechnology Development Co., Ltd
+86-0533-2185556 +8617865335152
Mandy@hangyubiotech.com China 10978 58
Shanghai Affida new material science and technology center
+undefined15081010295
admin@oudaxin.com China 114 58
Hangzhou Hyper Chemicals Limited
+86-0086-57187702781 +8613675893055
info@hyper-chem.com China 221 58
Alpha Biopharmaceuticals Co., Ltd
+86-15542445688
sales@alabiochem.com China 888 58
Shanghai Daken Advanced Materials Co.,Ltd
+86-371-66670886
info@dakenam.com China 16216 58
Henan Tianfu Chemical Co.,Ltd.
+86-0371-55170693 +86-19937530512
info@tianfuchem.com China 21670 55
career henan chemical co
+86-0371-86658258 +8613203830695
sales@coreychem.com China 29897 58

Exendin-4 관련 검색:

Copyright 2019 © ChemicalBook. All rights reserved