Welcome to chemicalbook!
400-158-6606
Inquriy
Try our best to find the right business for you.
Do not miss inquiry messages Please log in to view all inquiry messages.

Welcome back!

ChemicalBook >> CAS DataBase List >> LL-37

LL-37

LL-37 price.
  • $167 - $366
  • Product name: LL-37
  • CAS: 154947-66-7
  • MF: C205H340N60O53
  • MW: 0
  • EINECS:211-519-9
  • MDL Number:MFCD09264694
  • Synonyms:Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate
4 prices
Selected condition:
Brand
  • ApexBio Technology
  • Cayman Chemical
Package
  • 500μg
  • 500ug
  • 1mg
  • ManufacturerApexBio Technology
  • Product numberB7771
  • Product descriptionLL37
  • Packaging500ug
  • Price$193
  • Updated2021-12-16
  • Buy
  • ManufacturerApexBio Technology
  • Product numberB7771
  • Product descriptionLL37
  • Packaging1mg
  • Price$366
  • Updated2021-12-16
  • Buy
  • ManufacturerCayman Chemical
  • Product number24461
  • Product descriptionLL-37 (trifluoroacetate salt) ≥95%
  • Packaging500μg
  • Price$167
  • Updated2023-06-20
  • Buy
  • ManufacturerCayman Chemical
  • Product number24461
  • Product descriptionLL-37 (trifluoroacetate salt) ≥95%
  • Packaging1mg
  • Price$315
  • Updated2023-06-20
  • Buy
Manufacturer Product number Product description Packaging Price Updated Buy
ApexBio Technology B7771 LL37 500ug $193 2021-12-16 Buy
ApexBio Technology B7771 LL37 1mg $366 2021-12-16 Buy
Cayman Chemical 24461 LL-37 (trifluoroacetate salt) ≥95% 500μg $167 2023-06-20 Buy
Cayman Chemical 24461 LL-37 (trifluoroacetate salt) ≥95% 1mg $315 2023-06-20 Buy

Properties

solubility :Water: 1 mg/ml
form :A lyophilized powder
color :White to off-white
Water Solubility :Soluble to 1 mg/ml in water
InChIKey :POIUWJQBRNEFGX-XAMSXPGMSA-N

Safety Information

Symbol(GHS):
Signal word:
Hazard statements:
Code Hazard statements Hazard class Category Signal word Pictogram P-Codes
Precautionary statements:

Description

LL-37, Human acetate is a 37-residue, amphipathic, cathelicidin-derived antimicrobial peptide, which exhibits a broad spectrum of antimicrobial activity.

Related product price