ChemicalBook >> CAS DataBase List >>LL-37

LL-37

CAS No.
154947-66-7
Chemical Name:
LL-37
Synonyms
II37 Peptide;LL-37, LL37, CAMP;Cathelicidin LL-37;LL-37 human acetate;Cathelicidin LL 37 (human);LL-37 (trifluoroacetate salt);Antibacterial Protein LL-37 (human);[LL-37, 37 aa];Antibacterial Protein LL-37 (huMan), LL37, CAMP;Anti-Inflammatory Peptide Ll-37 (human) /Cathelicidin Ll-37
CBNumber:
CB02603131
Molecular Formula:
C205H340N60O53
Molecular Weight:
0
MDL Number:
MFCD09264694
MOL File:
Mol file
Last updated:2024-05-23 18:06:45

LL-37 Properties

solubility Water: 1 mg/ml
form A lyophilized powder
Water Solubility Soluble to 1 mg/ml in water
InChIKey POIUWJQBRNEFGX-XAMSXPGMSA-N
FDA UNII 3DD771JO2H

LL-37 price More Price(4)

Manufacturer Product number Product description CAS number Packaging Price Updated Buy
Cayman Chemical 24461 LL-37 (trifluoroacetate salt) ≥95% 154947-66-7 500μg $167 2023-06-20 Buy
Cayman Chemical 24461 LL-37 (trifluoroacetate salt) ≥95% 154947-66-7 1mg $315 2023-06-20 Buy
ApexBio Technology B7771 LL37 154947-66-7 1mg $366 2021-12-16 Buy
ApexBio Technology B7771 LL37 154947-66-7 500ug $193 2021-12-16 Buy
Product number Packaging Price Buy
24461 500μg $167 Buy
24461 1mg $315 Buy
B7771 1mg $366 Buy
B7771 500ug $193 Buy

LL-37 Chemical Properties,Uses,Production

Structure

The structure of LL-37 in SDS micelles is composed of a curved amphipathic helix-bend-helix motif spanning residues 2–31 followed by a disordered C-terminal tail. The helical bend is located between residues Gly-14 and Glu-16. Similar chemical shifts and 15N nuclear Overhauser effect (NOE) patterns of the peptide in complex with di octanoyl phosphatidylglycerol (D8PG) micelles indicate a similar structure. The aromatic rings of Phe-5, Phe-6, Phe-17, and Phe-27 of LL-37, as well as arginines, showed intermolecular NOE cross-peaks with D8PG, providing direct evidence for the association of the entire amphipathic helix with anionic lipid micelles. The structure of LL-37 serves as a model for understanding the structure and function relationship of homologous primate cathelicidins[5].

Description

LL-37, Human acetate is a 37-residue, amphipathic, cathelicidin-derived antimicrobial peptide, which exhibits a broad spectrum of antimicrobial activity.

Uses

L 37 (human) is a 37 amino acid host defense peptide originating from the C-terminal of the human cathelicidin antimicrobial peptide (CAMP, hCAP18). This peptide possesses antimicrobial, antitumor, antiviral, and immunomodulatory properties, along with physiological functions in chemotaxis, wound healing, and angiogenesis. Beyond its antimicrobial capabilities, LL 37 (human) influences various pathways in autoimmune and inflammatory diseases, playing a role in the development of lupus, rheumatoid arthritis, and atherosclerosis. As a binding partner to Aβ42, the expression of LL 37 (human) affects the onset and progression of Alzheimer's disease. Additionally, LL 37 has a notable role in human cancer, promoting tumorigenic effects in ovarian, lung, breast, prostate, pancreatic cancers, and malignant melanoma.

Origin

Mammalian AMPs belong to the defensin and cathelicidin families. So far, there is a unique cathelicidin peptide found in 1995 and called human cationic antimicrobial peptide (hCAP18). Its active part starts with double leucine and consists of 37-amino acids at the C-terminus, so which is called LL-37.

benefits

LL-37 is an important part of the human immune system, which can resist various pathogens. A plethora of experiments have demonstrated that it has the multifunctional effects of immune regulation, in addition to antimicrobial activity.  Significantly boosts immune function; Fights inflammation; Prevents cancer progression; Accelerates wound healing; Lowers the risk of heart disease; Prevents lung injury; Promotes bone repair.

Biological Activity

LL 37 is an antimicrobial peptide derivative of human cathelicidin. Induces FPRL1-mediated chemotaxis of human neutrophils, monocytes and T cells in vitro. Promotes wound healing following skin-targeted electroporation of a plasmid encoding hCAP-18/LL-37 in mice. LL 37 reduces SARS-CoV-2 infection by blocking the receptor binding domain of the S1 spike protein (Kd = 11.2 nM) and by binding to ACE2 (Kd = 25.5.nM). LL 37 inhibits SARS-CoV-2 pseudovirion infection (IC50 = 4.74 μg/mL) in vitro and in vivo. Also triggers apoptosis in colon cancer cells. Cell permeable.

Side effects

LL-37 side effects are very uncommon. LL-37 induced apparent rosacea symptoms, erythema, and telangiectasia on the skin. Side effects associated with LL-37 may include the following:
Increased inflammation
Induction of autoimmune disease
Depression
Damage to sperm surface membranes

storage

Store at -20°C

References

[1]Kahlenberg and Kaplan (2013) Little peptide, big effects: the role of LL-37 in inflammation and autoimmune disease. J. Immunol. 191(10) 4895 PMID: 24185823
[2]Bandurska et al (2015) Unique features of human cathelicidin LL‐37. BioFactors 41 289 PMID: 26434733
[3]Chen et al (2018) Roles and Mechanisms of Human Cathelicidin LL-37 in Cancer. Cell Physiol.Biochem. 47 1060 PMID: 29843147
[4]Vierthaler et al (2020) Fluctuating role of antimicrobial peptide hCAP18/LL?37 in oral tongue dysplasia and carcinoma. Oncol. Rep. 44 325 PMID: 32627035
[5]Wang, Guangshun. “Structures of human host defense cathelicidin LL-37 and its smallest antimicrobial peptide KR-12 in lipid micelles.” The Journal of Biological Chemistry 283 47 (2008): 32637–43.

LL-37 Preparation Products And Raw materials

Raw materials

Preparation Products

LL-37 Suppliers

Global( 111)Suppliers
Supplier Tel Email Country ProdList Advantage
Shanghai Affida new material science and technology center
+undefined15081010295 admin@oudaxin.com China 371 58
Sichuan Tai Hui Biotechnology Co., Ltd
+86-18224031330 +86-18081096520 404435307@qq.com China 25 58
Hebei Weimiao Import and Export Trade Co., Ltd.
+undefined19948166995 sale01@hbweimiao.com China 73 58
Zhejiang Hangyu API Co., Ltd
+8617531972939 anna@api-made.com China 2944 58
hebei hongtan Biotechnology Co., Ltd
+86-86-1913198-3935 +8617331935328 sales03@chemcn.cn China 952 58
CONTIDE BIOTECH CO.,LTD
+852-53358525 xena@healthtide-api.com China 619 58
Shanghai Getian Industrial Co., LTD
+86-15373193816 +86-15373193816 mike@ge-tian.com China 274 58
Hebei Anlijie Biotechnology Co., Ltd
+8619031013551 ably@aljbio.com China 189 58
Dorne Chemical Technology co. LTD
+86-13583358881 +86-18560316533 Ethan@dornechem.com China 295 58
Shanghai Yunao International Trade Co., Ltd
+8617621705551 asdf@shanghaihg.cn China 265 58

View Lastest Price from LL-37 manufacturers

Image Update time Product Price Min. Order Purity Supply Ability Manufacturer
LL-37 pictures 2024-05-26 LL-37
154947-66-7
US $1.00 / g 1g 99% 100kg Dorne Chemical Technology co. LTD
LL37 pictures 2024-05-24 LL37
154947-66-7
US $60.00-40.00 / BOX 1BOX 99.99% 1000 hebei hongtan Biotechnology Co., Ltd
LL 37 pictures 2024-05-24 LL 37
154947-66-7
US $30.00 / box 1box 98% 5000box hebei hongtan Biotechnology Co., Ltd
  • LL-37 pictures
  • LL-37
    154947-66-7
  • US $1.00 / g
  • 99%
  • Dorne Chemical Technology co. LTD
  • LL37 pictures
  • LL37
    154947-66-7
  • US $60.00-40.00 / BOX
  • 99.99%
  • hebei hongtan Biotechnology Co., Ltd
  • LL 37 pictures
  • LL 37
    154947-66-7
  • US $30.00 / box
  • 98%
  • hebei hongtan Biotechnology Co., Ltd
Antibacterial Protein LL-37 (huMan), LL37, CAMP H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH Antibacterial Protein LL-37 (human) LL-37 (trifluoroacetate salt) [LL-37, 37 aa] Cathelicidin LL 37 (human) LL-37, LL37, CAMP LL-37 human acetate Cathelicidin LL-37 Anti-Inflammatory Peptide Ll-37 (human) /Cathelicidin Ll-37 II37 Peptide 154947-66-7 C205H340N60O53