CJC1295

CJC1295 Struktur
863288-34-0
CAS-Nr.
863288-34-0
Englisch Name:
CJC1295
Synonyma:
CJC-1295 Acetate;CJC1295;CJC1295 DCA;CJC-1295(2MG);sarms CJC1295;CJC-1295(10mg);CJC 1295 w/o DAC;CJC-1295 CJC-1295;CJC1295 with out DAC;CJC1295 No DAC acetate
CBNumber:
CB01470921
Summenformel:
C152H252N44O42
Molgewicht:
3367.89688
MOL-Datei:
863288-34-0.mol

CJC1295 Eigenschaften

Schmelzpunkt:
> 177° C (dec.)
Dichte
1.45
storage temp. 
-20°C Freezer, Under inert atmosphere
Löslichkeit
Ethanol (Slightly, Heated, Sonicated), Methanol (Slightly), Water (Slightly)
Aggregatzustand
Solid
Farbe
White to Off-White
InChIKey
XOZMWINMZMMOBR-HRDSVTNWSA-N
Sicherheit
  • Risiko- und Sicherheitserklärung
  • Gefahreninformationscode (GHS)
Bildanzeige (GHS) GHS hazard pictograms
Alarmwort Achtung
Gefahrenhinweise
Code Gefahrenhinweise Gefahrenklasse Abteilung Alarmwort Symbol P-Code
H314 Verursacht schwere Verätzungen der Haut und schwere Augenschäden. Ätzwirkung auf die Haut Kategorie 1B Achtung GHS hazard pictogramssrc="/GHS05.jpg" width="20" height="20" /> P260,P264, P280, P301+P330+ P331,P303+P361+P353, P363, P304+P340,P310, P321, P305+ P351+P338, P405,P501
H318 Verursacht schwere Augenschäden. Schwere Augenschädigung Kategorie 1 Achtung GHS hazard pictogramssrc="/GHS05.jpg" width="20" height="20" /> P280, P305+P351+P338, P310
Sicherheit
P280 Schutzhandschuhe/Schutzkleidung/Augenschutz tragen.
P301+P330+P331 BEI VERSCHLUCKEN: Mund ausspülen. KEIN Erbrechen herbeiführen.
P302+P352 BEI BERÜHRUNG MIT DER HAUT: Mit viel Wasser/... (Hersteller kann, falls zweckmäßig, ein Reinigungsmittel angeben oder, wenn Wasser eindeutig ungeeignet ist, ein alternatives Mittel empfehlen) waschen.
P304+P340 BEI EINATMEN: Die Person an die frische Luft bringen und für ungehinderte Atmung sorgen.
P305+P351+P338 BEI KONTAKT MIT DEN AUGEN: Einige Minuten lang behutsam mit Wasser spülen. Eventuell vorhandene Kontaktlinsen nach Möglichkeit entfernen. Weiter spülen.
P310 Sofort GIFTINFORMATIONSZENTRUM/Arzt/ anrufen.

CJC1295 Chemische Eigenschaften,Einsatz,Produktion Methoden

Beschreibung

CJC-1295 is an incredibly effective growth hormone and works by causing another substance to be secreted. It stimulates the release of your own body’s growth hormone which. Research show that after the age of 30 the body’s growth hormone level drops quickly and approximately 15% every 10 years. CJC-1295 is able to increase growth hormone naturally by binding to receptors for growth hormone releasing hormone (GHRH) on your brain and more specifically the pituitary gland.

Verwenden

CJC 1295 Acetate is used in application of growth hormone releasing hormone agonist to preparing anti-aging agent.

benefits

CJC1295 is a chemically synthesised peptide that significantly promotes the release of growth hormone by activating the pituitary gland. Receiving CJC-1295 peptide therapy has multiple benefits, including: increased metabolism and energy, decreased body fat and increased muscle mass, optimised immune system, improved bone density, improved sleep, shorter recovery time, repair of injuries, improved skin elasticity, reduced wrinkles, strengthened nails and hair, and more.

Pharmakologie

By doing this it triggers the brain to release growth hormone that would have otherwise been lost with age. Research completed with healthy men and women between the ages of 21 and 61, showed that CJC-1295 had the ability to increase serum growth hormone levels by 200-1000%. In these individuals, the elevated growth hormone production and release continued for up to 6 days because CJC-1295 has a half life of about 6-8 days. This longer half-life means the body continues to produces beyond the day of injection and is thought to be a great benefit has compared to other peptides that also have similar actions. For this reason and a few more, CJC-1295 has become very effective peptide for safely increasing growth hormone levels.

Clinical Use

CJC 1295 allows the anterior pituitary to follow the natural, pulsatile release of growth hormone without an increase in appetite stimulation, cortisol, acetylcholine, prolactin, and aldosterone. Typically, you will see CJC compounded with Ipamorelin due to its ability to stimulate GHRH for enhanced results.Increased GH secretion and IFG-1 levels;Increased muscle growth;Increased bone density;Improved cognitive function and memory;Increased cellular repair and regeneration;Increased fat loss;Taken before bed to maximize the natural cycle of growth hormone.

Nebenwirkungen

CJC-1295 is safely biologically increased growth hormone levels without the side of effects of other medication such hGH treatment which have been none to have more side effects. Some of the side effects of CJC-1295 are generally mild and tend to not last long if at all such as headache, flushing, and dizziness. The most common reported side effect is redness and irritation at the injection site.

CJC1295 Upstream-Materialien And Downstream Produkte

Upstream-Materialien

Downstream Produkte


CJC1295 Anbieter Lieferant Produzent Hersteller Vertrieb Händler.

Global( 161)Lieferanten
Firmenname Telefon E-Mail Land Produktkatalog Edge Rate
Hebei Xunou new energy Technology Co., LTD
+undefined17531957005
xunou8@hbxunou.com China 36 58
Changzhou Xuanming Pharmaceutical Technology Co., Ltd.
+8618068519287
sales@xuanmingchem.com China 882 58
Zhuzhou Yaozhijie Chemical Co., LTD
+8618073316972
sales@goodpeptides.com China 244 58
Wuhan Godbullraw Chemical Co.,ltd
+undefined18986288449
Alisasales@godbullraw.com China 560 58
Hebei Nafu Technology Co. , Ltd.
+8615075022224
17745771666@hebeinafu.com China 325 58
Hubei Lange Biotechnology Co., Ltd.
+8617762501948
sales2@langebiotech.com China 154 58
Hebei Yinsheng Technology Co., Ltd.
+86-17331136691
lemon@hbyinsheng.com China 622 58
Hebei Gongyuan New Material Technology Co., Ltd.
+8617331136198
Grace@hebeisyjl.com China 497 58
Wuhan Cell Pharmaceutical Co., Ltd
+86-13129979210 +86-13129979210
sales@cellwh.com China 376 58
Hebei Mojin Biotechnology Co., Ltd
+8613288715578
sales@hbmojin.com China 12450 58

863288-34-0()Verwandte Suche:


  • CJC1295
  • Y(d -A)DAIFTQSYRKVLAQLSARKLLQDILSR-NH2
  • L-Tyrosyl-D-alanyl-L-alpha-aspartyl-L-alanyl-L-isoleucyl-L-phenylalanyl-L-threonyl-L-glutaminyl-L-seryl-L-tyrosyl-L-arginyl-L-lysyl-L-valyl-L-leucyl-L-alanyl-L-glutaminyl-L-seryl-L-alanyl-L-arginyl-L-lysyl-L-leucyl-L-leucyl-L-glutaminyl-L-alpha-aspartyl-L-isoleucyl-L-leucyl-L-seryl-L-arginyl-N6-[3-(2,5-dihydro-2,5-dioxo-1H-pyrrol-1-yl)-1-oxopropyl]-L-lysinamide
  • CJC-1295 CJC-1295
  • CJC1295 with out DAC
  • -L-arginyl-L-lysyl-L-leucyl-L-leucyl-L-glutaminyl
  • CJC-1295(2MG)
  • CJC-1295(10mg)
  • CJC-1295 Without DAC 86328-34-0
  • CJC-1295 Acetate without DAC
  • Peptides Bodybuilding cjc-1295
  • Human Growth Peptide Cjc 1295 with Dac/Cjc 1295 Without Dac 2mg/Vials
  • CJC1295 No DAC acetate
  • CJC 1295 w/o DAC
  • CJC1295 with DAC, MK677, Melanotan 2, huperzine A, minoxidil sulfate, RU58841, SAG
  • CJC-1295 Acetate
  • sarms CJC1295
  • CJC-1295 Whitout DAC/CJC-1295 DAC/CJC-1295
  • CJC1295 DCA
  • CJC-1295(DAC/Without DAC)
  • 863288-34-0
  • 156-1-5
  • 86328-34-0
  • C159H258N46O45
  • Peptides
  • CJC
  • 863288-34-0
Copyright 2019 © ChemicalBook. All rights reserved