ChemicalBook > Product Catalog >Biochemical Engineering >Polypeptide >Exendin-3 (9-39) amide

Exendin-3 (9-39) amide

CAS No.: 133514-43-9

Chemical Name:: Exendin-3 (9-39) amide

Synonyms: EXENDIN (9-39);EXENDIN 3 (9-39);Exendin-4 (9-39);Hexanal Impurity 5;EXENDIN (9-39) AMIDE;EXENDIN FRAGMENT 9-39;EXENDIN-3 (9-39) AMIDE;EXENDIN [9-39] PEPTIDE;Exendin (9-39) Acetate;Exendin 4 (9-39) amide

CBNumber:: CB0109941

Molecular Formula:: C149H234N40O47S

Molecular Weight:: 3369.76

MOL File:: 133514-43-9.mol

Modify Date:: 2024/7/2 8:54:55

Request For Quotation

Exendin-3 (9-39) amide Properties

Density	1.51
RTECS	LF2460000
storage temp.	Keep in dark place,Inert atmosphere,Store in freezer, under -20°C
solubility	H2O : 50 mg/mL (14.84 mM; Need ultrasonic)
form	Solid
color	Off-white to pale purple
Water Solubility	Soluble in water at 1mg/ml
InChIKey	WSEVKKHALHSUMB-UHFFFAOYSA-N

SAFETY

Risk and Safety Statements

WGK Germany	3

Exendin-3 (9-39) amide price More Price(1)

Manufacturer	Product number	Product description	CAS number	Packaging	Price	Updated	Buy
Sigma-Aldrich(India)	E7269	Exendin Fragment 9-39 ≥95% (HPLC)	133514-43-9	0.1MG	₹37367.9	2022-06-14	Buy

Product number	Packaging	Price	Buy
E7269	0.1MG	₹37367.9	Buy

Exendin-3 (9-39) amide Chemical Properties,Uses,Production

Description

Exendin-3 (9-39) amide is a truncated form of the exendin-4 peptide that acts as a potent competitive antagonist for the glucagon-like peptide 1 receptor (GLP-1R; K_d = 1.7 nM in CHL cells transfected with cloned human GLP-1). It inhibits exendin-3-induced increases in cAMP levels in guinea pig pancreas cells (IC₅₀ = 20 nM). Exendin-3 (9-39) amide administration in the hypothalamus (10 and 100 μg, i.c.v.) reverses GLP-1 inhibition of feeding behavior in rats.

Uses

Biological probe.

General Description

Exendin Fragment 9-39 is an antagonist of glucagon-like peptide-1 (GLP-1) receptor, and also acts as an inhibitor of glucosedependent insulinotropic polypeptide (GIP)-receptor binding. It also prevents the production of cAMP by GIP. GLP-1, along with GIP, acts as a physiological incretin.

Exendin-3 (9-39) amide Preparation Products And Raw materials

Raw materials

Preparation Products

Exendin-3 (9-39) amide Suppliers

Global( 142)Suppliers

Supplier	Tel	Country	ProdList	Advantage	Inquiry
Hebei Duling International Trade Co. LTD	+8617333973358	China	15438	58	Inquiry
Shenzhen Nexconn Pharmatechs Ltd	+86-755-89396905 +86-15013857715	China	10259	58	Inquiry
Hebei Guanlang Biotechnology Co., Ltd.	+86-19930503282	China	8828	58	Inquiry
BOC Sciences	+1-631-485-4226	United States	19553	58	Inquiry
Cellmano Biotech Limited	0551-65326643 18156095617	China	999	58	Inquiry
CONIER CHEM AND PHARMA LIMITED	+8618523575427	China	49391	58	Inquiry
Dideu Industries Group Limited	+86-29-89586680 +86-15129568250	China	26216	58	Inquiry
Zhejiang J&C Biological Technology Co.,Limited	+1-2135480471 +1-2135480471	China	10522	58	Inquiry
Guangzhou TongYi biochemistry technology Co.,LTD	+8613073028829	China	2996	58	Inquiry
Alfa Chemistry	+1-5166625404	United States	21317	58	Inquiry

Supplier	Advantage
Hebei Duling International Trade Co. LTD	58
Shenzhen Nexconn Pharmatechs Ltd	58
Hebei Guanlang Biotechnology Co., Ltd.	58
BOC Sciences	58
Cellmano Biotech Limited	58
CONIER CHEM AND PHARMA LIMITED	58
Dideu Industries Group Limited	58
Zhejiang J&C Biological Technology Co.,Limited	58
Guangzhou TongYi biochemistry technology Co.,LTD	58
Alfa Chemistry	58

133514-43-9(Exendin-3 (9-39) amide)Related Search:

OMEGA-CONOTOXIN MVIIC SDV-Exendin-3/4 EXENDIN-4 (3-39) Rosiptor Alendronate sodium

Topiramate EXENDIN-3 EXENDIN 4, FAM-LABELED Exenatide acetate Exendin-3 (9-39) amide

chevron_left

1of2

chevron_right

ASP-LEU-SER-LYS-GLN-MET-GLU-GLU-GLU-ALA-VAL-ARG-LEU-PHE-ILE-GLU-TRP-LEU-LYS-ASN-GLY-GLY-PRO-SER-SER-GLY-ALA-PRO-PRO-PRO-SER-NH2 H-ASP-LEU-SER-LYS-GLN-MET-GLU-GLU-GLU-ALA-VAL-ARG-LEU-PHE-ILE-GLU-TRP-LEU-LYS-ASN-GLY-GLY-PRO-SER-SER-GLY-ALA-PRO-PRO-PRO-SER-NH2 EXENDIN 3 (9-39) EXENDIN-3 (9-39) AMIDE EXENDIN (9-39) EXENDIN (9-39) AMIDE EXENDIN [9-39] PEPTIDE EXENDIN FRAGMENT 9-39 DLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2 M.W. 3369.79 C149H234N40O47S ASP-LEU-SER-LYS-GLN-MET-GLU-GLU-GLU-ALA-VAL-ARG-LEU-PHE-ILE-GLU-TRP-LEU-LYS-ASN-GLY-GLY-PRO-SER-SER-GLY-ALA-PRO-PRO-PRO-SER-NH2: DLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2 Exendin 3 (heloderma horridum), 1-de-L-histidine-2-de-L-serine-3-de-L-aspartic acid-4-deglycine-5-de-L-threonine-6-de-L-phenylalanine-7-de-L-threonine-8-de-L-serine- 9-39-Exendin 3(Heloderma horridum) EXENDIN FRAGMENT 9-39;EXENDIN (9-39) H-Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2 Exendin FragMent 9-39Exendin H-Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2 acetate salt 9-39-Exendin 3(Heloderma horridum) (9CI) Exendin (9-39) Acetate Exendin 4 (9-39) amide Asp-LEU-SER-LYS-GLN-MET-GLU-GLU-GLU-ALA-VAL-ARG-LEU-PHE-ILE-GLU-TRp-LEU-LYS-ASN-GLY-GLY-PRO-SER-SER-GLY-ALA-PRO-PRO-PRO-SER-NH2, ≥95%(HPLC) L-Serinamide, L-α-aspartyl-L-leucyl-L-seryl-L-lysyl-L-glutaminyl-L-methionyl-L-α-glutamyl-L-α-glutamyl-L-α-glutamyl-L-alanyl-L-valyl-L-arginyl-L-leucyl-L-phenylalanyl-L-isoleucyl-L-α-glutamyl-L-tryptophyl-L-leucyl-L-lysyl-L-asparaginylglycylglycyl-L-prolyl-L-seryl-L-serylglycyl-L-alanyl-L-prolyl-L-p... Exendin Fragment 9-39 >=95% (HPLC) Exendin-3 (9-39) amide USP/EP/BP GCGR,Glucagon Receptor,Avexitide,Inhibitor,inhibit Exendin-3 (9-39) amide/Avexitide Hexanal Impurity 5 Asp-LEU-SER-LYS-GLN-MET-GLU-GLU-GLU-ALA-VAL-ARG-LEU-PHE-ILE-GLU-TR|p|-LEU-LYS-ASN-GLY-GLY-PRO-SER-SER-GLY-ALA-PRO-PRO-PRO-SER-NH2 Exendin-4 (9-39) 133514-43-9 C149H234N40O47S C149H234N40O47S1 Hormones Obesity Research Exendin Cytokines, Growth Factors and Hormones BioChemical Cell Biology Cell Signaling and Neuroscience Peptide GLP-1 Receptor LigandsObesity Research Cytokines Growth Factors and Hormones (Obesity) ExendinPeptides for Cell Biology Hormones Obesity Peptides Obesity Research Other Obesity Research Products Glucagon receptor and related