GRF (1-44) (HUMAN) price,buy GRF (1-44) (HUMAN)

Welcome to chemicalbook!

400-158-6606

18162-48-6 872-50-4 Methylene Chloride naphthalene THF Titanium Dioxide

Structured search

Inquriy

Try our best to find the right business for you.

Messages

Do not miss inquiry messages Please log in to view all inquiry messages.

My chemicalbook

Welcome back!

ChemicalBook > Product Catalogue >Biochemical Engineering >Polypeptide >GRF (1-44) (HUMAN)

GRF (1-44) (HUMAN)

₹0
Product name: GRF (1-44) (HUMAN)
CAS: 83930-13-6
MF: C215H358N72O66S
MW: 5039.65082
EINECS:
MDL Number:MFCD00081671
Synonyms:SERMORELIN (HUMAN);SOMATOCRININ (HUMAN);SOMATOLIBERIN (HUMAN);SOMATORELIN;YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2;TYR-ALA-ASP-ALA-ILE-PHE-THR-ASN-SER-TYR-ARG-LYS-VAL-LEU-GLY-GLN-LEU-SER-ALA-ARG-LYS-LEU-LEU-GLN-ASP-ILE-MET-SER-ARG-GLN-GLN-GLY-GLU-SER-ASN-GLN-GLU-ARG-GLY-ALA-ARG-ALA-ARG-LEU-NH2;GRF (huMan) SoMatoliberin (huMan), SoMatocrinin (huMan), SoMatorelin (huMan), Growth HorMone-Releasing Factor (huMan), Growth HorMone-Releasing HorMone (huMan), GHRH (huMan), SoMatorelin;SoMatoliberin (huMan), SoMatocrinin (huMan), SoMatorelin (huMan), Growth HorMone-Releasing Factor (huMan), Growth HorMone-Releasing HorMone (huMan), GHRH (huMan), SoMatorelin

Properties Safety Information Description

Manufacturer	Product number	Product description	Packaging	Price	Updated	Buy

Properties

storage temp. :−20°C
form :powder
color :White to off-white
Water Solubility :Water : 25 mg/mL (4.96 mM)

Safety Information

Symbol(GHS):

Signal word:

Hazard statements:

Code	Hazard statements	Hazard class	Category	Signal word	Pictogram	P-Codes

Precautionary statements:

Description

GHRH is expressed and secreted from the hypothalamic neurons of the arcuate nucleus (ARC). GHRH stimulates the release of growth hormone (GH) in the anterior pituitary. In 1982, three isoforms of GHRH(1–37, 1–40, 1–44 aa residues) were initially isolated from human pancreatic tumors that caused acromegaly, and the latter two were found in the human hypothalamus. The aa sequence of GHRH was also identified in various vertebrates from rodents to fish, including a protochordate. In nonmammalian vertebrates, GHRH-like peptide (pituitary adenylate cyclase-activating polypeptide (PACAP)-related peptide in mammals) was first isolated like GHRH, although the GHRH-like peptide had less activity on GH release. Later, actual GHRH, which was more phylogenetically and structurally similar to mammalian GHRH and showed GH-releasing activity, was isolated in nonmammalian vertebrates.

More related product prices

SOMATOSTATIN 28, CYCLIC prosomatostatin Somatostatin Tosylmethyl isocyanide Ethyl isocyanoacetate METHYL ISOCYANOACETATE 1,1,3,3-TETRAMETHYLBUTYL ISOCYANIDE PHENYLSELENOL Sermorelin TERT-BUTYL ISOCYANIDE