LL-37
- CAS No.
- 154947-66-7
- Chemical Name:
- LL-37
- Synonyms
- II37 Peptide;LL-37, LL37, CAMP;Cathelicidin LL-37;LL-37 human acetate;Cathelicidin LL 37 (human);LL-37 (trifluoroacetate salt);Antibacterial Protein LL-37 (human);[LL-37, 37 aa];Antibacterial Protein LL-37 (huMan), LL37, CAMP;Anti-Inflammatory Peptide Ll-37 (human) /Cathelicidin Ll-37
- CBNumber:
- CB02603131
- Molecular Formula:
- C205H340N60O53
- Molecular Weight:
- 0
- MOL File:
- Mol file
- Modify Date:
- 2024/7/25 20:04:51
LL-37 Chemical Properties,Uses,Production
Description
LL-37, Human acetate is a 37-residue, amphipathic, cathelicidin-derived antimicrobial peptide, which exhibits a broad spectrum of antimicrobial activity.
Uses
L 37 (human) is a 37 amino acid host defense peptide originating from the C-terminal of the human cathelicidin antimicrobial peptide (CAMP, hCAP18). This peptide possesses antimicrobial, antitumor, antiviral, and immunomodulatory properties, along with physiological functions in chemotaxis, wound healing, and angiogenesis. Beyond its antimicrobial capabilities, LL 37 (human) influences various pathways in autoimmune and inflammatory diseases, playing a role in the development of lupus, rheumatoid arthritis, and atherosclerosis. As a binding partner to Aβ42, the expression of LL 37 (human) affects the onset and progression of Alzheimer's disease. Additionally, LL 37 has a notable role in human cancer, promoting tumorigenic effects in ovarian, lung, breast, prostate, pancreatic cancers, and malignant melanoma.
Origin
Mammalian AMPs belong to the defensin and cathelicidin families. So far, there is a unique cathelicidin peptide found in 1995 and called human cationic antimicrobial peptide (hCAP18). Its active part starts with double leucine and consists of 37-amino acids at the C-terminus, so which is called LL-37.
benefits
LL-37 is an important part of the human immune system, which can resist various pathogens. A plethora of experiments have demonstrated that it has the multifunctional effects of immune regulation, in addition to antimicrobial activity.
Significantly boosts immune function;
Fights inflammation; Prevents cancer progression;
Accelerates wound healing;
Lowers the risk of heart disease; Prevents lung injury;
Promotes bone repair.
Biological Activity
LL 37 is an antimicrobial peptide derivative of human cathelicidin. Induces FPRL1-mediated chemotaxis of human neutrophils, monocytes and T cells in vitro. Promotes wound healing following skin-targeted electroporation of a plasmid encoding hCAP-18/LL-37 in mice. LL 37 reduces SARS-CoV-2 infection by blocking the receptor binding domain of the S1 spike protein (Kd = 11.2 nM) and by binding to ACE2 (Kd = 25.5.nM). LL 37 inhibits SARS-CoV-2 pseudovirion infection (IC50 = 4.74 μg/mL) in vitro and in vivo. Also triggers apoptosis in colon cancer cells. Cell permeable.
Side effects
LL-37 side effects are very uncommon. LL-37 induced apparent rosacea symptoms, erythema, and telangiectasia on the skin. Side effects associated with LL-37 may include the following:
Increased inflammation
Induction of autoimmune disease
Depression
Damage to sperm surface membranes
References
[1]Kahlenberg and Kaplan (2013) Little peptide, big effects: the role of LL-37 in inflammation and autoimmune disease. J. Immunol. 191(10) 4895 PMID: 24185823
[2]Bandurska et al (2015) Unique features of human cathelicidin LL‐37. BioFactors 41 289 PMID: 26434733
[3]Chen et al (2018) Roles and Mechanisms of Human Cathelicidin LL-37 in Cancer. Cell Physiol.Biochem. 47 1060 PMID: 29843147
[4]Vierthaler et al (2020) Fluctuating role of antimicrobial peptide hCAP18/LL?37 in oral tongue dysplasia and carcinoma. Oncol. Rep. 44 325 PMID: 32627035
[5]Wang, Guangshun. “Structures of human host defense cathelicidin LL-37 and its smallest antimicrobial peptide KR-12 in lipid micelles.” The Journal of Biological Chemistry 283 47 (2008): 32637–43.
LL-37 Preparation Products And Raw materials
Raw materials
Preparation Products
LL-37 Suppliers
| Supplier | Tel | Country | ProdList | Advantage | Inquiry |
|---|---|---|---|---|---|
| Shanghai Affida new material science and technology center | +undefined15081010295 | China | 114 | 58 | Inquiry |
| Sichuan Tai Hui Biotechnology Co., Ltd | +86-18224031330 +86-18081096520 | China | 24 | 58 | Inquiry |
| Hebei Weimiao Import and Export Trade Co., Ltd. | +undefined19948166995 | China | 73 | 58 | Inquiry |
| hebei hongtan Biotechnology Co., Ltd | +86-86-1913198-3935 +8617331935328 | China | 973 | 58 | Inquiry |
| CONTIDE BIOTECH CO.,LTD | +852-53358525 | China | 572 | 58 | Inquiry |
| Shanghai Getian Industrial Co., LTD | +86-15373193816 +86-15373193816 | China | 269 | 58 | Inquiry |
| Strong peptide cross-border e-commerce Co. LTD | +undefined13930052870 | China | 84 | 58 | Inquiry |
| Qingdao Xinli Technology Development Co., Ltd. | +8616632313095 | China | 135 | 58 | Inquiry |
| Dorne Chemical Technology co. LTD | +86-86-13583358881 +8618560316533 | China | 3146 | 58 | Inquiry |
| Shanghai Yunao International Trade Co., Ltd | +8617621705551 | China | 265 | 58 | Inquiry |
154947-66-7(LL-37)Related Search:
1of4
chevron_right