Welcome to chemicalbook!
400-158-6606
Try our best to find the right business for you.
Do not miss inquiry messages Please log in to view all inquiry messages.

Welcome back!

ChemicalBook > Product Catalogue >API >Hormones and the Endocrine System >Pancreatic hormone and blood sugar regulation >Glucagon

Glucagon

Glucagon Structure
  • ₹11907.5 - ₹116531.13
  • Product name: Glucagon
  • CAS: 16941-32-5
  • MF: C153H225N43O49S
  • MW: 3482.75
  • EINECS:685-611-6
  • MDL Number:MFCD00167532
  • Synonyms:GLUCAGON 1-37;GLUCAGON (1-37) (PORCINE);GLUCAGON 37;GLUCAGON ACETATE;HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNKNNIA;H-HIS-SER-GLN-GLY-THR-PHE-THR-SER-ASP-TYR-SER-LYS-TYR-LEU-ASP-SER-ARG-ARG-ALA-GLN-ASP-PHE-VAL-GLN-TRP-LEU-MET-ASN-THR-LYS-ARG-ASN-LYS-ASN-ASN-ILE-ALA-OH;Glucagon 1-29;Glucagon(1-29) Human HCl
5 prices
Selected condition:

Brand

  • Sigma-Aldrich(India)

Package

  • 0.1MG
  • 1MG
  • 5MG
  • 25MG
  • ManufacturerSigma-Aldrich(India)
  • Product numberG2044
  • Product descriptionGlucagon synthetic, powder, suitable for cell culture
  • Packaging1MG
  • Price₹11907.5
  • Updated2022-06-14
  • Buy
  • ManufacturerSigma-Aldrich(India)
  • Product numberG1774
  • Product descriptionGlucagon ≥95% (HPLC), powder, synthetic
  • Packaging0.1MG
  • Price₹21000.5
  • Updated2022-06-14
  • Buy
  • ManufacturerSigma-Aldrich(India)
  • Product numberG2044
  • Product descriptionGlucagon synthetic, powder, suitable for cell culture
  • Packaging5MG
  • Price₹32085.3
  • Updated2022-06-14
  • Buy
  • ManufacturerSigma-Aldrich(India)
  • Product numberG1774
  • Product descriptionGlucagon ≥95% (HPLC), powder, synthetic
  • Packaging1MG
  • Price₹106117.48
  • Updated2022-06-14
  • Buy
  • ManufacturerSigma-Aldrich(India)
  • Product numberG2044
  • Product descriptionGlucagon synthetic, powder, suitable for cell culture
  • Packaging25MG
  • Price₹116531.13
  • Updated2022-06-14
  • Buy
Manufacturer Product number Product description Packaging Price Updated Buy
Sigma-Aldrich(India) G2044 Glucagon synthetic, powder, suitable for cell culture 1MG ₹11907.5 2022-06-14 Buy
Sigma-Aldrich(India) G1774 Glucagon ≥95% (HPLC), powder, synthetic 0.1MG ₹21000.5 2022-06-14 Buy
Sigma-Aldrich(India) G2044 Glucagon synthetic, powder, suitable for cell culture 5MG ₹32085.3 2022-06-14 Buy
Sigma-Aldrich(India) G1774 Glucagon ≥95% (HPLC), powder, synthetic 1MG ₹106117.48 2022-06-14 Buy
Sigma-Aldrich(India) G2044 Glucagon synthetic, powder, suitable for cell culture 25MG ₹116531.13 2022-06-14 Buy

Properties

Density :1.53±0.1 g/cm3(Predicted)
storage temp. :Keep in dark place,Sealed in dry,2-8°C
solubility :Practically insoluble in water and in most organic solvents. It is soluble in dilute mineral acids and in dilute solutions of alkali hydroxides.
form :powder
color :White to off-white
Water Solubility :Soluble to 1 mg/ml in water
InChIKey :MASNOZXLGMXCHN-SXVMFYJYNA-N

Safety Information

Symbol(GHS): GHS hazard pictogramsGHS hazard pictograms
Signal word: Danger
Hazard statements:
Code Hazard statements Hazard class Category Signal word Pictogram P-Codes
H317 May cause an allergic skin reaction Sensitisation, Skin Category 1 Warning GHS hazard pictograms P261, P272, P280, P302+P352,P333+P313, P321, P363, P501
H332 Harmful if inhaled Acute toxicity,inhalation Category 4 Warning GHS hazard pictograms P261, P271, P304+P340, P312
H334 May cause allergy or asthma symptoms or breathing difficulties if inhaled Sensitisation, respiratory Category 1 Danger GHS hazard pictograms P261, P285, P304+P341, P342+P311,P501
Precautionary statements:
P261 Avoid breathing dust/fume/gas/mist/vapours/spray.
P271 Use only outdoors or in a well-ventilated area.
P272 Contaminated work clothing should not be allowed out of the workplace.
P280 Wear protective gloves/protective clothing/eye protection/face protection.
P285 In case of inadequate ventilation wear respiratory protection.
P302+P352 IF ON SKIN: wash with plenty of soap and water.
P304+P340 IF INHALED: Remove victim to fresh air and Keep at rest in a position comfortable for breathing.
P304+P341 IF INHALED: If breathing is difficult, remove victim to fresh air and keep at rest in a position comfortable for breathing.
P312 Call a POISON CENTER or doctor/physician if you feel unwell.
P321 Specific treatment (see … on this label).
P333+P313 IF SKIN irritation or rash occurs: Get medical advice/attention.
P342+P311 IF experiencing respiratory symptoms: call a POISON CENTER or doctor/physician.
P363 Wash contaminated clothing before reuse.
P501 Dispose of contents/container to..…

Description

A peptide hormone that plays a role in maintaining glucose homeostasis

Related product price