LL-37
|
|
- ₹0
- Product name: LL-37
- CAS: 154947-66-7
- MF: C205H340N60O53
- MW: 0
- EINECS:211-519-9
- MDL Number:MFCD09264694
- Synonyms:Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate
| Manufacturer | Product number | Product description | Packaging | Price | Updated | Buy |
|---|
Properties
solubility :Water: 1 mg/ml
form :A lyophilized powder
color :White to off-white
Water Solubility :Soluble to 1 mg/ml in water
InChIKey :POIUWJQBRNEFGX-XAMSXPGMSA-N
form :A lyophilized powder
color :White to off-white
Water Solubility :Soluble to 1 mg/ml in water
InChIKey :POIUWJQBRNEFGX-XAMSXPGMSA-N
Safety Information
| Symbol(GHS): | ||||||||
|---|---|---|---|---|---|---|---|---|
| Signal word: | ||||||||
| Hazard statements: |
|
|||||||
| Precautionary statements: |
|
Description
LL-37, Human acetate is a 37-residue, amphipathic, cathelicidin-derived antimicrobial peptide, which exhibits a broad spectrum of antimicrobial activity.More related product prices
AC-MURAMYL-ALA-GLU-NH2 beta-Amyloid (1-42) human Argireline ADRENOMEDULLIN (HUMAN) 127650-08-2 N-Acetyl-L-alpha-glutamyl-L-alpha-glutamyl-L-methionyl-L-glutaminyl-L-arginyl-L-arginyl-L-alanyl-L-alpha-asparagine Thymosin alpha 1 318480-38-5 GAP 26 82911-69-1 DERMASEPTIN CECROPIN P1 (PORCINE) 147396-10-9 ALLOFERON 1Related product price
- beta-Amyloid (1-42) human
₹26174.85-33320 - Argireline
₹37530.28 - ADRENOMEDULLIN (HUMAN)
₹52468.78
