Welcome to chemicalbook!
China english Japan Germany India
400-158-6606
18162-48-6872-50-4Methylene ChloridenaphthaleneTHFTitanium Dioxide
Structured search
Inquriy
Try our best to find the right business for you.
Messages
Do not miss inquiry messages Please log in to view all inquiry messages.
head sculpture My chemicalbook

Welcome back!

RFQ
skype
MY Account
Top
ChemicalBook > Product Catalogue >Biochemical Engineering >Amino Acids and Derivatives >Other Amino Acid Protection >Teriparatide acetate

Teriparatide acetate

Teriparatide acetate Structure
  • ₹15274.08 - ₹42975.25
  • Product name: Teriparatide acetate
  • CAS: 52232-67-4
  • MF: C172H278N52O47S2
  • MW: 3890.49792
  • EINECS:640-978-1
  • MDL Number:MFCD00149013
  • Synonyms:PARATHYROID HORMONE HUMAN: FRAGMENT 1-34;PARATHYROID HORMONE (HUMAN, 1-34);PARATHYROID HORMONE (1-34), HUMAN;PTH (HUMAN, 1-34);Teriparatide acetate;SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF;SER-VAL-SER-GLU-ILE-GLN-LEU-MET-HIS-ASN-LEU-GLY-LYS-HIS-LEU-ASN-SER-MET-GLU-ARG-VAL-GLU-TRP-LEU-ARG-LYS-LYS-LEU-GLN-ASP-VAL-HIS-ASN-PHE;SER-VAL-SER-GLU-ILE-GLN-LEU-MET-HIS-ASN-LEU-GLY-LYS-HIS-LEU-ASN-SER-MET-GLU-ARG-VAL-GLU-TRP-LEU-ARG-LYS-LYS-LEU-GLN-ASP-VAL-HIS-ASN-PHE HUMAN
Price4 Properties Safety Information Description
4 prices
Selected condition：

Brand

  • Sigma-Aldrich(India)

Package

  • 0.1MG
  • 0.5MG
  • 1MG
  • ManufacturerSigma-Aldrich(India)
  • Product numberP3796
  • Product descriptionParathyroid Hormone Fragment 1-34 human ≥95% (HPLC), powder
  • Packaging0.1MG
  • Price₹15274.08
  • Updated2022-06-14
  • Buy
  • ManufacturerSigma-Aldrich(India)
  • Product number05-23-5501
  • Product descriptionParathyroid Hormone 1-34, Human - CAS 52232-67-4 - Calbiochem N-terminal active peptide fragment of the native hormone that functions as a regulatory factor in the homeostatic control of Ca2+ and phosphate metabo
  • Packaging1MG
  • Price₹22380
  • Updated2022-06-14
  • Buy
  • ManufacturerSigma-Aldrich(India)
  • Product numberP3796
  • Product descriptionParathyroid Hormone Fragment 1-34 human ≥95% (HPLC), powder
  • Packaging0.5MG
  • Price₹23879.95
  • Updated2022-06-14
  • Buy
  • ManufacturerSigma-Aldrich(India)
  • Product numberP3796
  • Product descriptionParathyroid Hormone Fragment 1-34 human ≥95% (HPLC), powder
  • Packaging1MG
  • Price₹42975.25
  • Updated2022-06-14
  • Buy
Manufacturer Product number Product description Packaging Price Updated Buy
Sigma-Aldrich(India) P3796 Parathyroid Hormone Fragment 1-34 human ≥95% (HPLC), powder 0.1MG ₹15274.08 2022-06-14 Buy
Sigma-Aldrich(India) 05-23-5501 Parathyroid Hormone 1-34, Human - CAS 52232-67-4 - Calbiochem N-terminal active peptide fragment of the native hormone that functions as a regulatory factor in the homeostatic control of Ca2+ and phosphate metabo 1MG ₹22380 2022-06-14 Buy
Sigma-Aldrich(India) P3796 Parathyroid Hormone Fragment 1-34 human ≥95% (HPLC), powder 0.5MG ₹23879.95 2022-06-14 Buy
Sigma-Aldrich(India) P3796 Parathyroid Hormone Fragment 1-34 human ≥95% (HPLC), powder 1MG ₹42975.25 2022-06-14 Buy

Properties

Melting point :>205oC (dec.)
RTECS :SQ7770000
storage temp. :−20°C
solubility :DMSO (Slightly), Water (Slightly)
form :powder
color :White to Off-White
Water Solubility :Soluble to 0.40 mg/ml in water
Sequence :H-Ser-Val-Ser-Glu-Ile-Gln-Leu-Met-His-Asn-Leu-Gly-Lys-His-Leu-Asn-Ser-Met-Glu-Arg-Val-Glu-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-His-Asn-Phe-OH
Stability :Hygroscopic
CAS DataBase Reference :52232-67-4(CAS DataBase Reference)

Safety Information

Symbol(GHS): GHS hazard pictograms
Signal word: Warning
Hazard statements:
Code Hazard statements Hazard class Category Signal word Pictogram P-Codes
H227 Combustible liquid Flammable liquids Category 4 Warning P210, P280, P370+P378, P403+P235,P501
H302 Harmful if swallowed Acute toxicity,oral Category 4 Warning GHS hazard pictograms P264, P270, P301+P312, P330, P501
Precautionary statements:
P210 Keep away from heat/sparks/open flames/hot surfaces. — No smoking.
P264 Wash hands thoroughly after handling.
P264 Wash skin thouroughly after handling.
P270 Do not eat, drink or smoke when using this product.
P280 Wear protective gloves/protective clothing/eye protection/face protection.
P301+P312 IF SWALLOWED: call a POISON CENTER or doctor/physician IF you feel unwell.
P330 Rinse mouth.
P370+P378 In case of fire: Use … for extinction.
P403+P235 Store in a well-ventilated place. Keep cool.
P501 Dispose of contents/container to..…

Description

A fragment of human parathyroid hormone (hPTH) peptide sequence containing the 34 N-terminal residues of hPTH. This fragment was also found to be an agonist at PTH1 and PTH2 receptors.

More related product prices

Oxytocin Melanotan II Cosyntropin N-(N-(N-Glycylglycyl)glycyl)-8-L-lysinevasopressin Angiotensin acetate Pramlintide acetate Desmopressin Triptorelin acetate 86220-42-0 Ganirelix Leuprorelin acetate Eptifibatide Eledoisin VAPREOTIDE Leuprorelin 37025-55-1 Argipressine

Related product price

Suppliers and manufacturers

Hebei Xinsheng New Material Technology Co., LTD.
teriparatide
₹0.00 /1box
teriparatide CAS:52232-67-4
Zibo Hangyu Biotechnology Development Co., Ltd
Teriparatide acetate
₹90.00 /1KG
Teriparatide acetate CAS:52232-67-4
Hebei Weimiao Import and Export Trade Co., Ltd.
Teriparatide
₹160.00 /10Box
Teriparatide CAS:52232-67-4
Shanghai Getian Industrial Co., LTD
Teriparatide acetate
₹26.00 /1box
Teriparatide acetate CAS:52232-67-4
Shaanxi TNJONE Pharmaceutical Co., Ltd
Teriparatide acetate
₹0.00 /1g
Teriparatide acetate CAS:52232-67-4
Manus Aktteva CLEARSYNTH LABS LTD. Pharmaffiliates Analytics and Synthetics P. Ltd Sudarshan Pharma Industries Limited
Cellmano Biotech Limited