ChemicalBook > Product Catalog >Biochemical Engineering >Amino Acids and Derivatives >Other Amino Acid Protection >Teriparatide acetate

Teriparatide acetate

Teriparatide acetate Structure
CAS No.
52232-67-4
Chemical Name:
Teriparatide acetate
Synonyms
Parathar;hPTH (1-34);Teriparatid;Teroparatide;CNV-38d(1-34);Teriparatide CRS;PTH (HUMAN, 1-34);Teriparatida(net);PTH (1-34) (HUMAN);Parathormone (1-34)
CBNumber:
CB2284468
Molecular Formula:
C172H278N52O47S2
Molecular Weight:
3890.49792
MOL File:
52232-67-4.mol
MSDS File:
SDS
Modify Date:
2024/7/9 21:58:15

Teriparatide acetate Properties

Melting point >205oC (dec.)
RTECS SQ7770000
storage temp. −20°C
solubility DMSO (Slightly), Water (Slightly)
form powder
color White to Off-White
Water Solubility Soluble to 0.40 mg/ml in water
Sequence H-Ser-Val-Ser-Glu-Ile-Gln-Leu-Met-His-Asn-Leu-Gly-Lys-His-Leu-Asn-Ser-Met-Glu-Arg-Val-Glu-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-His-Asn-Phe-OH
Stability Hygroscopic
CAS DataBase Reference 52232-67-4(CAS DataBase Reference)

SAFETY

Risk and Safety Statements

Symbol(GHS) 
GHS07
Signal word  Warning
Hazard statements  H302-H227
Precautionary statements  P210-P264-P270-P280-P301+P312-P330-P370+P378-P403+P235-P501
WGK Germany  3
HS Code  2937190000

Teriparatide acetate price More Price(4)

Manufacturer Product number Product description CAS number Packaging Price Updated Buy
Sigma-Aldrich(India) P3796 Parathyroid Hormone Fragment 1-34 human ≥95% (HPLC), powder 52232-67-4 0.1MG ₹15274.08 2022-06-14 Buy
Sigma-Aldrich(India) P3796 Parathyroid Hormone Fragment 1-34 human ≥95% (HPLC), powder 52232-67-4 0.5MG ₹23879.95 2022-06-14 Buy
Sigma-Aldrich(India) P3796 Parathyroid Hormone Fragment 1-34 human ≥95% (HPLC), powder 52232-67-4 1MG ₹42975.25 2022-06-14 Buy
Sigma-Aldrich(India) 05-23-5501 Parathyroid Hormone 1-34, Human - CAS 52232-67-4 - Calbiochem N-terminal active peptide fragment of the native hormone that functions as a regulatory factor in the homeostatic control of Ca2+ and phosphate metabo 52232-67-4 1MG ₹22380 2022-06-14 Buy
Product number Packaging Price Buy
P3796 0.1MG ₹15274.08 Buy
P3796 0.5MG ₹23879.95 Buy
P3796 1MG ₹42975.25 Buy
05-23-5501 1MG ₹22380 Buy

Teriparatide acetate Chemical Properties,Uses,Production

Description

The anabolic drug teriparatide acetate (TA), known as recombinant human parathyroid hormone 1–34, which directly promotes bone formation by generating new osteocytes, has been introduced as a novel therapeutic agent for osteoporosis. Distinct from antiresorptive drug treatment, patients with osteonecrosis of the jaw showed successful clinical outcomes after weekly administration of TA. In addition, adverse outcomes of long-term bisphosphonate treatment, such as bone fracture, were healed after usage of TA, and better bone mass and mineral density improvements at the lumbar spine and femoral neck were achieved with TA treatment than with bisphosphonate treatment[1].

Uses

A fragment of human parathyroid hormone (hPTH) peptide sequence containing the 34 N-terminal residues of hPTH. This fragment was also found to be an agonist at PTH1 and PTH2 receptors.

General Description

Teriparatide is a recombinantform of parathyroid hormone, which is used for the treatmentof osteoporosis in men and postmenopausal women.The N-terminal region possesses 34 amino acids, which areidentical to the biologically active region of the 84-aminoacid sequence of human parathyroid hormone. It has beenshown to act on osteoblasts to stimulate new bone growthand improve bone density.

Pharmacokinetics

If administered once daily or intermittently, teriparatide preferentially enhances osteoblastic function,and bone formation occurs. Continuous exposure to endogenous PTH may result in poor skeletal composition because of enhanced osteoclast-mediated bone resorption. After 18 months of treatment, lumbar BMD increased up to 12% in postmenopausal women. After 10 months of treatment, 53% of men had an increase of 5% or greater in spine BMD. The risk for developing new vertebral fractures was reduced by 65% after 21 months of treatment, and the number of nonvertebral fragility fractures was reduced by 53%.

Clinical Use

In 2002, the U.S. FDA approved teriparatide for the treatment of postmenopausal osteoporosis in patients who have a high risk of fracture as well as to increase bone mass in men with primary or hypogonadal osteoporosis who have a high risk of fracture. Teriparatide is recombinant human PTH 1-34, the biologically active portion of the endogenously produced preprohormone. Unlike the bisphosphonates, which are classified as bone restorative agents, teriparatide is the first approved bone-forming agent. Bone formation is possible because of the ability of this agent to increase the number of osteoblasts. Although teriparatide enhances the function of both osteoclasts and osteoblasts, the exposure incidence dictates its effect on the skeleton.

Side effects

Temporary increases in serum calcium levels occur following administration of teriparatide. As a result, this agent is contraindicated in patients who are predisposed to hypercalcemia. Some evidence suggests that these elevations in serum calcium levels may cause a patient who is taking digitalis to experience digitalis toxicity (39). Teriparatide should not be prescribed to patients with Paget's disease, children, young adults, women who are pregnant or nursing, and those patients who have received skeletal radiation therapy. Because of an increased incidence of osteosarcoma (malignant bone tumors) observed in rats, teriparatide also carries a black box warning

Dosage

Teriparatide acetate requires subcutaneous injection into the thigh or abdominal wall, and the recommended dose is 20 mcg once daily. If symptoms of orthostatic hypotension occur, it is administered while the patient is sitting or lying down. It is not recommended to use the drug for more than 2 years in the lifetime of the patient. Use teriparatide injection with caution in patients receiving digoxin. Transient hypercalcemia may predispose patients to digitalis toxicity.

References

[1] Jeeho Sim. “Development of Clinical Weekly-Dose Teriparatide Acetate Encapsulated Dissolving Microneedle Patch for Efficient Treatment of Osteoporosis.” Polymers (2022).

Teriparatide acetate Preparation Products And Raw materials

Raw materials

Preparation Products

Global( 398)Suppliers
Supplier Tel Country ProdList Advantage Inquiry
Manus Aktteva +91 (79) 6512-3395 New Delhi, India 581 34 Inquiry
CLEARSYNTH LABS LTD. +91-22-45045900 Hyderabad, India 6351 58 Inquiry
Pharmaffiliates Analytics and Synthetics P. Ltd +91-172-5066494 Haryana, India 6773 58 Inquiry
Sudarshan Pharma Industries Limited 07942563481 Mumbai, India 3 58 Inquiry
Sea Biological Co.,LTD +86-13865152372 +86-13865152372 China 71 58 Inquiry
Cellmano Biotech Limited 0551-65326643 18156095617 China 999 58 Inquiry
Hebei Xinsheng New Material Technology Co., LTD. +86-16632316109 China 1090 58 Inquiry
Zibo Hangyu Biotechnology Development Co., Ltd +86-0533-2185556 +8617865335152 China 10978 58 Inquiry
Hebei Weimiao Import and Export Trade Co., Ltd. +undefined19948166995 China 73 58 Inquiry
Shanghai Getian Industrial Co., LTD +86-15373193816 +86-15373193816 China 269 58 Inquiry

Related articles

Teriparatide acetate Spectrum

PARATHYROID HORMONE HUMAN: FRAGMENT 1-34 PARATHYROID HORMONE (HUMAN, 1-34) PARATHYROID HORMONE (1-34), HUMAN PTH (HUMAN, 1-34) Teriparatide acetate SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF SER-VAL-SER-GLU-ILE-GLN-LEU-MET-HIS-ASN-LEU-GLY-LYS-HIS-LEU-ASN-SER-MET-GLU-ARG-VAL-GLU-TRP-LEU-ARG-LYS-LYS-LEU-GLN-ASP-VAL-HIS-ASN-PHE SER-VAL-SER-GLU-ILE-GLN-LEU-MET-HIS-ASN-LEU-GLY-LYS-HIS-LEU-ASN-SER-MET-GLU-ARG-VAL-GLU-TRP-LEU-ARG-LYS-LYS-LEU-GLN-ASP-VAL-HIS-ASN-PHE HUMAN Pth(1-34)(human) Acetate Parathormone (1-34) [CYS5,28] PARATHYROID HORMONE (1-34), HUMAN [CYS5,28] PTH (1-34), HUMAN H-SER-VAL-SER-GLU-ILE-GLN-LEU-MET-HIS-ASN-LEU-GLY-LYS-HIS-LEU-ASN-SER-MET-GLU-ARG-VAL-GLU-TRP-LEU-ARG-LYS-LYS-LEU-GLN-ASP-VAL-HIS-ASN-PHE-OH Teriparatide (Forteo) PARATHYROID HORMONE FRAGMENT HUMAN 1-34 APPROX. 95% PARATHYROID HORMONE FRAGMENT HUMAN 1-34 90-95% Teriparatide, Parathyroid Hormone(1-34),human parathyroid hormone fragment 1-34 human PARATHYROID HORMONE (PTH) HUMAN 1-34, MIN 95% (1-34)-HUMAN PARATHYROID HORMONE Teriparatide, Parathyroid Hormone(1-34) ALA-VAL-SER-GLU-ILE-GLN-LEU-MET-HIS-ASN-LEU-GLY-LYS-HIS-LEU-ALA-SER-VAL-GLU-ARG-MET-GLN-TRP-LEU-ARG-LYS-LYS-LEU-GLN-ASP-VAL-HIS-ASN-PHE: AVSEIQLMHNLGKHLASVERMQWLRKKLQDVHNF SER-VAL-SER-GLU-CYS-GLN-LEU-MET-HIS-ASN-LEU-GLY-LYS-HIS-LEU-ASN-SER-MET-GLU-ARG-VAL-GLU-TRP-LEU-ARG-LYS-LYS-CYS-GLN-ASP-VAL-HIS-ASN-PHE Teriparatide acetate/HuMan PTH(1-34) M.W. 4117.72 C181H291N55O51S2 Parathyroid Hormone Fragment (1-34) H-Ser-Val-Ser-Glu-Ile-Gln-Leu-Met-His-Asn-Leu-Gly-Lys-His-Leu-Asn-Ser-Met-Glu-Arg-Val-Glu-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-His-Asn-Phe-OH acetate salt PTH (1-34) (HUMAN) Parathyroid Hormone (PTH) (1-34), Human Teroparatide CNV-38d(1-34) Teriparatide, Teriparatida , Teriparatidum Teriparatide (PTH 1-34) hPTH (1-34) PTH 1-34;HPTH (1-34);HUMAN PARATHYROID HORMONE-(1-34) Pterospermum heterophyllum Hance. Parathyroid Hormone 1-34, Human - CAS 52232-67-4 - Calbiochem Teriparatide,PTH 1-34,hPTH (1-34),Human parathyroid hormone-(1-34), >99% Teriparatide CRS Teriparatide?Acetate impurity Teriparatide acetate USP/EP/BP Teriparatide,PTH 1-34,hPTH (1-34),Human parathyroid hormone-(1-34) Teriparatide Acetate/pTH(1-34) human Pteris formosana extract Teriparatide D10 AcetateQ: What is Teriparatide D10 Acetate Q: What is the CAS Number of Teriparatide D10 Acetate Q: What is the storage condition of Teriparatide D10 Acetate Q: What are the applications of Teriparatide D10 Acetate TeriparatideAcetateQ: What is TeriparatideAcetate Q: What is the CAS Number of TeriparatideAcetate Q: What is the storage condition of TeriparatideAcetate Q: What are the applications of TeriparatideAcetate Teriparatida(net) pTH (1-34) (human) Acetate(net) Teriparatide (COLD SHIPMENT REQUIRED) (1643962) Teriparatide (Y0001916) Teriparatide for system suitability (Y0001895) leriparatide acetate TeripaRatide Acetate peptide Terliparatide Acetate Teriparatide acetate Powder CNV-38d(1-34),Parathyroid Hormone (1-34), human Parathar Teriparatide Acetate(free base)