Welcome to chemicalbook!
400-158-6606
Try our best to find the right business for you.
Do not miss inquiry messages Please log in to view all inquiry messages.

Welcome back!

ChemicalBook > Product Catalogue >Biochemical Engineering >Polypeptide >Exendin-4

Exendin-4

Exendin-4 Structure
  • ₹27473.85 - ₹83092.7
  • Product name: Exendin-4
  • CAS: 141758-74-9
  • MF: C184H282N50O60S
  • MW: 4186.57188
  • EINECS:686-356-3
  • MDL Number:MFCD00240171
  • Synonyms:EXENDIN-4;M.W. 4186.61 C184H282N50O60S;HIS-GLY-GLU-GLY-THR-PHE-THR-SER-ASP-LEU-SER-LYS-GLN-MET-GLU-GLU-GLU-ALA-VAL-ARG-LEU-PHE-ILE-GLU-TRP-LEU-LYS-ASN-GLY-GLY-PRO-SER-SER-GLY-ALA-PRO-PRO-PRO-SER-NH2;HIS-GLY-GLU-GLY-THR-PHE-THR-SER-ASP-LEU-SER-LYS-GLN-MET-GLU-GLU-GLU-ALA-VAL-ARG-LEU-PHE-ILE-GLU-TRP-LEU-LYS-ASN-GLY-GLY-PRO-SER-SER-GLY-ALA-PRO-PRO-PRO-SER-NH2: HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2;Exenatide, AC 2993, Exendin A, ExendinA;Exendin-4 Exenatide;Exenatide (Exendin-4);Exenatide free base
2 prices
Selected condition:

Brand

  • Sigma-Aldrich(India)

Package

  • 500μG
  • 0.1MG
  • ManufacturerSigma-Aldrich(India)
  • Product numberE7144
  • Product descriptionExendin-4 ≥97%
  • Packaging0.1MG
  • Price₹27473.85
  • Updated2022-06-14
  • Buy
  • ManufacturerSigma-Aldrich(India)
  • Product numberE7144
  • Product descriptionExendin-4 ≥97%
  • Packaging500μG
  • Price₹83092.7
  • Updated2022-06-14
  • Buy
Manufacturer Product number Product description Packaging Price Updated Buy
Sigma-Aldrich(India) E7144 Exendin-4 ≥97% 0.1MG ₹27473.85 2022-06-14 Buy
Sigma-Aldrich(India) E7144 Exendin-4 ≥97% 500μG ₹83092.7 2022-06-14 Buy

Properties

RTECS :VT9545000
storage temp. :−20°C
solubility :≥145 mg/mL in DMSO; insoluble in EtOH; ≥52 mg/mL in H2O with gentle warming
form :White to off-white solid.
color :White to off-white
Water Solubility :Soluble in water (1 mg/ml)
InChIKey :HTQBXNHDCUEHJF-AAPNSGCPNA-N

Safety Information

Symbol(GHS): GHS hazard pictograms
Signal word: Warning
Hazard statements:
Code Hazard statements Hazard class Category Signal word Pictogram P-Codes
H351 Suspected of causing cancer Carcinogenicity Category 2 Warning P201, P202, P281, P308+P313, P405,P501
H361 Suspected of damaging fertility or the unborn child Reproductive toxicity Category 2 Warning P201, P202, P281, P308+P313, P405,P501
Precautionary statements:
P201 Obtain special instructions before use.
P202 Do not handle until all safety precautions have been read and understood.
P281 Use personal protective equipment as required.
P308+P313 IF exposed or concerned: Get medical advice/attention.
P405 Store locked up.
P501 Dispose of contents/container to..…

Description

Exenatide is the first drug in a new class of anti-diabetics known as the incretin mimetics, and it is indicated as adjunctive therapy to improve glycemic control in patients with type 2 diabetes who are taking metformin, a sulfonylurea, or both, but have not achieved adequate glycemic control. Exenatide is a functional analog of the human incretin Glucagon-Like Peptide-1 (GLP-1). GLP-1 is naturally released from cells in the GI tract in response to food intake and acts on its receptor on b-cells to potentiate glucose-stimulated insulin secretion. Exenatide is a long-acting agonist at the GLP-1 receptor. It is a synthetic version of a 39-amino acid peptide found in the salivary secretions of the Gila monster lizard.also moderates peak serum glucagon levels during hyperglycemic periods following meals, but does not interfere with glucagon release in response to hypoglycemia. The dosing regimen for exenatide is 5 or 10 mg twice daily, administered as a subcutaneous injection within an hour before morning and evening meals. Following subcutaneous administration, peak plasma concentrations of exenatide are reached in 2.1 h, and the plasma pharmacokinetic profile is dose proportional. The most common adverse events reported with exenatide include nausea, vomiting, diarrhea, feeling jittery, dizziness, headache, and dyspepsia.

Related product price